PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_31678-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 185aa    MW: 21006.5 Da    PI: 6.0342
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_31678-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.98e-1287135351
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      e +r rr+ +NRe+ArrsR RK++++ +L   v  L   N++L ++l++
  TRIUR3_31678-P1  87 EERRRRRMVSNRESARRSRVRKQKQLGQLWAQVVHLRDANRDLLDQLNR 135
                      56899**************************************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.2E-884135No hitNo description
SMARTSM003381.1E-884149IPR004827Basic-leucine zipper domain
PfamPF001701.3E-987135IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.56587135IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-1089135No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
CDDcd147022.37E-1294136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MYPAEVAGVL LPAAYLPPPA NAASLGPHYP YQMEEDDHLL FQCSSSSLMQ LPYADELFLN  60
HPPAVPLRNG SSSDEPAAHA VDRQRAEERR RRRMVSNRES ARRSRVRKQK QLGQLWAQVV  120
HLRDANRDLL DQLNRAIVDY DRVVRDNSRM RDERAELQRR LRELPVVDAG DAEGVAVGED  180
DESTV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
188109RRRRRMVSNRESARRSRVRKQK
2101107RRSRVRK
3101108RRSRVRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7308971e-71EU730897.1 Brachypodium distachyon clone BAC DB038O09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229875.22e-45PREDICTED: basic leucine zipper 43-like
TrEMBLM7YWV91e-131M7YWV9_TRIUA; G-box-binding factor 1
STRINGSi019897m9e-43(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-10basic leucine-zipper 42